SCOPe 2.08: Domain d6xp0d2: 6xp0 D:165-273

Lineage for d6xp0d2 (6xp0 D:165-273)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)

8. Domain d6xp0d2: 6xp0 D:165-273 [396327]
   Other proteins in same PDB: d6xp0a1, d6xp0a3, d6xp0b1, d6xp0b3, d6xp0c1, d6xp0c3, d6xp0d1, d6xp0d3, d6xp0e1
   automated match to d2izzc2
   complexed with fpk

Details for d6xp0d2

PDB Entry: 6xp0, 1.95 Å

PDB Description: structure of human pycr1 complexed with n-formyl l-proline

PDB Compounds: (D:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d6xp0d2:

Sequence; same for both SEQRES and ATOM records:

>d6xp0d2 a.100.1.0 (D:165-273) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmad

Timeline for d6xp0d2:

• d6xp0d2 first appeared in SCOPe 2.07