Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
Protein automated matches [190563] (18 species) not a true protein |
Species Escherichia virus t4 [TaxId:10665] [396296] (2 PDB entries) |
Domain d6xc1a_: 6xc1 A: [396323] automated match to d226la_ complexed with edo, ipa |
PDB Entry: 6xc1 (more details), 1.92 Å
SCOPe Domain Sequences for d6xc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xc1a_ d.2.1.0 (A:) automated matches {Escherichia virus t4 [TaxId: 10665]} smaemlrrdeglrlkvywdtegyptigighlimkqpvrdmaqinkvlskqvgreitgnpg sitmeeattlferdladmqrdikshskvgpvwqavnrsrqmalenmafqmgvggvakfnt mltamlagdwekaykagrdslwyqqtkgrasrvtmiiltgnlesygv
Timeline for d6xc1a_: