Lineage for d6xc1a_ (6xc1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926515Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2926516Protein automated matches [190563] (18 species)
    not a true protein
  7. 2926528Species Escherichia virus t4 [TaxId:10665] [396296] (2 PDB entries)
  8. 2926531Domain d6xc1a_: 6xc1 A: [396323]
    automated match to d226la_
    complexed with edo, ipa

Details for d6xc1a_

PDB Entry: 6xc1 (more details), 1.92 Å

PDB Description: crystal structure of bacteriophage t4 spackle and lysozyme in orthorhombic form
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d6xc1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xc1a_ d.2.1.0 (A:) automated matches {Escherichia virus t4 [TaxId: 10665]}
smaemlrrdeglrlkvywdtegyptigighlimkqpvrdmaqinkvlskqvgreitgnpg
sitmeeattlferdladmqrdikshskvgpvwqavnrsrqmalenmafqmgvggvakfnt
mltamlagdwekaykagrdslwyqqtkgrasrvtmiiltgnlesygv

SCOPe Domain Coordinates for d6xc1a_:

Click to download the PDB-style file with coordinates for d6xc1a_.
(The format of our PDB-style files is described here.)

Timeline for d6xc1a_: