SCOP 1.75: Domain d8rucl_: 8ruc L:

Lineage for d8rucl_ (8ruc L:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)

8. Domain d8rucl_: 8ruc L: [39632]
   Other proteins in same PDB: d8ruca1, d8ruca2, d8rucc1, d8rucc2, d8ruce1, d8ruce2, d8rucg1, d8rucg2
   complexed with cap, mg

Details for d8rucl_

PDB Entry: 8ruc, 1.6 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate

PDB Compounds: (L:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d8rucl_:

Sequence; same for both SEQRES and ATOM records:

>d8rucl_ d.73.1.1 (L:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

Timeline for d8rucl_:

• d8rucl_ first appeared (with stable ids) in SCOP 1.55
  
• d8rucl_ appears in SCOP 1.73
  
• d8rucl_ appears in SCOPe 2.01
  
• d8rucl_ appears in the current release, SCOPe 2.08