Lineage for d8ruck_ (8ruc K:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) 
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species) Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries) 
Domain d8ruck_: 8ruc K: [39631]
Other proteins in same PDB: d8ruca1, d8ruca2, d8rucc1, d8rucc2, d8ruce1, d8ruce2, d8rucg1, d8rucg2
Details for d8ruck_
PDB Entry: 8ruc (more details), 1.6 Å
PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate
SCOP Domain Sequences for d8ruck_:
Sequence; same for both SEQRES and ATOM records: (download)
>d8ruck_ d.73.1.1 (K:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy
SCOP Domain Coordinates for d8ruck_:
Click to download the PDB-style file with coordinates for d8ruck_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d8ruck_:
- d8ruck_ appears in SCOP 1.57
- d8ruck_ appears in the current release, SCOPe 2.08
View in 3D
