| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries) |
| Domain d8rucj_: 8ruc J: [39630] Other proteins in same PDB: d8ruca1, d8ruca2, d8rucc1, d8rucc2, d8ruce1, d8ruce2, d8rucg1, d8rucg2 |
PDB Entry: 8ruc (more details), 1.6 Å
SCOP Domain Sequences for d8rucj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d8rucj_ d.73.1.1 (J:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy
Timeline for d8rucj_: