Lineage for d8ruci_ (8ruc I:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413835Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 413836Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 413837Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 413838Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 413878Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)
  8. 413879Domain d8ruci_: 8ruc I: [39629]
    Other proteins in same PDB: d8ruca1, d8ruca2, d8rucc1, d8rucc2, d8ruce1, d8ruce2, d8rucg1, d8rucg2

Details for d8ruci_

PDB Entry: 8ruc (more details), 1.6 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate

SCOP Domain Sequences for d8ruci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8ruci_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOP Domain Coordinates for d8ruci_:

Click to download the PDB-style file with coordinates for d8ruci_.
(The format of our PDB-style files is described here.)

Timeline for d8ruci_: