Lineage for d1burv_ (1bur V:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134572Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
  4. 134573Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 134574Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 134575Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 134591Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)
  8. 134595Domain d1burv_: 1bur V: [39628]
    Other proteins in same PDB: d1bura1, d1bura2, d1burb1, d1burb2, d1burc1, d1burc2, d1burd1, d1burd2

Details for d1burv_

PDB Entry: 1bur (more details), 1.8 Å

PDB Description: ribulose 1,5-bisphosphate carboxylase/oxygenase complexed with carbon dioxide, mg2+ and 2-carboxyarabinitol-1,5-bisphosphate

SCOP Domain Sequences for d1burv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1burv_ d.73.1.1 (V:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilgmkkyetlsylppltteqllaevnyllvnnwipclefevkdgfvyrehhkspg
yydgrywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdnkrqvqcisfiaykp
agy

SCOP Domain Coordinates for d1burv_:

Click to download the PDB-style file with coordinates for d1burv_.
(The format of our PDB-style files is described here.)

Timeline for d1burv_: