Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [377132] (6 PDB entries) |
Domain d6x9rh_: 6x9r H: [396257] automated match to d4y5xa_ complexed with nag |
PDB Entry: 6x9r (more details), 3.1 Å
SCOPe Domain Sequences for d6x9rh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x9rh_ b.1.1.1 (H:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} evqlvetggglvqpggslklscrasgytfssfamswvrqapgkglewvslindrggltfy vdsvkgrftisrdnskntlslqmhslrdgdtavyycatggmssalqsskyyfdfwgqgal vtvs
Timeline for d6x9rh_: