Lineage for d6x9rh_ (6x9r H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745451Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [377132] (6 PDB entries)
  8. 2745454Domain d6x9rh_: 6x9r H: [396257]
    automated match to d4y5xa_
    complexed with nag

Details for d6x9rh_

PDB Entry: 6x9r (more details), 3.1 Å

PDB Description: hiv-1 envelope glycoprotein bg505 sosip.664 expressed in hek293f cells in complex with rm20a3 fab
PDB Compounds: (H:) RM20A3 Fab Heavy Chain

SCOPe Domain Sequences for d6x9rh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x9rh_ b.1.1.1 (H:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
evqlvetggglvqpggslklscrasgytfssfamswvrqapgkglewvslindrggltfy
vdsvkgrftisrdnskntlslqmhslrdgdtavyycatggmssalqsskyyfdfwgqgal
vtvs

SCOPe Domain Coordinates for d6x9rh_:

Click to download the PDB-style file with coordinates for d6x9rh_.
(The format of our PDB-style files is described here.)

Timeline for d6x9rh_: