Lineage for d1burs_ (1bur S:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81179Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
  4. 81180Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 81181Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 81182Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species)
  7. 81193Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)
  8. 81194Domain d1burs_: 1bur S: [39625]
    Other proteins in same PDB: d1bura1, d1bura2, d1burb1, d1burb2, d1burc1, d1burc2, d1burd1, d1burd2

Details for d1burs_

PDB Entry: 1bur (more details), 1.8 Å

PDB Description: ribulose 1,5-bisphosphate carboxylase/oxygenase complexed with carbon dioxide, mg2+ and 2-carboxyarabinitol-1,5-bisphosphate

SCOP Domain Sequences for d1burs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1burs_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilgmkkyetlsylppltteqllaevnyllvnnwipclefevkdgfvyrehlkspg
yydgrywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdnkrqvqcisfiaykp
agy

SCOP Domain Coordinates for d1burs_:

Click to download the PDB-style file with coordinates for d1burs_.
(The format of our PDB-style files is described here.)

Timeline for d1burs_: