Lineage for d6x1pa1 (6x1p A:93-181)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2396113Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2396114Protein automated matches [190436] (9 species)
    not a true protein
  7. 2396309Species Monosiga brevicollis [TaxId:81824] [396210] (3 PDB entries)
  8. 2396312Domain d6x1pa1: 6x1p A:93-181 [396246]
    Other proteins in same PDB: d6x1pa2
    automated match to d3axaa_

Details for d6x1pa1

PDB Entry: 6x1p (more details), 1.7 Å

PDB Description: crystal structure of choanoflagellate (monosiga brevicollis) dlg1 pdz2 (mbdlg-2) in spacegroup i2
PDB Compounds: (A:) mbDLG protein

SCOPe Domain Sequences for d6x1pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x1pa1 b.36.1.0 (A:93-181) automated matches {Monosiga brevicollis [TaxId: 81824]}
etislhrqhgrglgftiaggqgsphiagddgifiskiipdsaakedgrlavgdrvlsvqg
escekitheravemlrnpaspivlvvehn

SCOPe Domain Coordinates for d6x1pa1:

Click to download the PDB-style file with coordinates for d6x1pa1.
(The format of our PDB-style files is described here.)

Timeline for d6x1pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6x1pa2