![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
![]() | Protein automated matches [190436] (9 species) not a true protein |
![]() | Species Monosiga brevicollis [TaxId:81824] [396210] (3 PDB entries) |
![]() | Domain d6x1pa1: 6x1p A:93-181 [396246] Other proteins in same PDB: d6x1pa2 automated match to d3axaa_ |
PDB Entry: 6x1p (more details), 1.7 Å
SCOPe Domain Sequences for d6x1pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6x1pa1 b.36.1.0 (A:93-181) automated matches {Monosiga brevicollis [TaxId: 81824]} etislhrqhgrglgftiaggqgsphiagddgifiskiipdsaakedgrlavgdrvlsvqg escekitheravemlrnpaspivlvvehn
Timeline for d6x1pa1: