SCOPe 2.08: Domain d6x1pa1: 6x1p A:93-181

Lineage for d6x1pa1 (6x1p A:93-181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Monosiga brevicollis [TaxId:81824] [396210] (3 PDB entries)

8. Domain d6x1pa1: 6x1p A:93-181 [396246]
   Other proteins in same PDB: d6x1pa2
   automated match to d3axaa_

Details for d6x1pa1

PDB Entry: 6x1p, 1.7 Å

PDB Description: crystal structure of choanoflagellate (monosiga brevicollis) dlg1 pdz2 (mbdlg-2) in spacegroup i2

PDB Compounds: (A:) mbDLG protein

SCOPe Domain Sequences for d6x1pa1:

Sequence; same for both SEQRES and ATOM records:

>d6x1pa1 b.36.1.0 (A:93-181) automated matches {Monosiga brevicollis [TaxId: 81824]}
etislhrqhgrglgftiaggqgsphiagddgifiskiipdsaakedgrlavgdrvlsvqg
escekitheravemlrnpaspivlvvehn

Timeline for d6x1pa1:

• d6x1pa1 first appeared in SCOPe 2.07