Lineage for d4rubt_ (4rub T:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413835Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 413836Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 413837Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 413838Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 413919Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries)
  8. 413926Domain d4rubt_: 4rub T: [39622]
    Other proteins in same PDB: d4ruba1, d4ruba2, d4rubb1, d4rubb2, d4rubc1, d4rubc2, d4rubd1, d4rubd2

Details for d4rubt_

PDB Entry: 4rub (more details), 2.7 Å

PDB Description: a crystal form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from nicotiana tabacum in the activated state

SCOP Domain Sequences for d4rubt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rubt_ d.73.1.1 (T:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaevgeakkaypqawiriigfdnvrqvqcisfiaykp
egy

SCOP Domain Coordinates for d4rubt_:

Click to download the PDB-style file with coordinates for d4rubt_.
(The format of our PDB-style files is described here.)

Timeline for d4rubt_: