Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (9 species) not a true protein |
Species Monosiga brevicollis [TaxId:81824] [396210] (3 PDB entries) |
Domain d6x1ra1: 6x1r A:93-187 [396211] Other proteins in same PDB: d6x1ra2 automated match to d3axaa_ complexed with gol |
PDB Entry: 6x1r (more details), 1.3 Å
SCOPe Domain Sequences for d6x1ra1:
Sequence, based on SEQRES records: (download)
>d6x1ra1 b.36.1.0 (A:93-187) automated matches {Monosiga brevicollis [TaxId: 81824]} etislhrqhgrglgftiaggqgsphiagddgifiskiipdsaakedgrlavgdrvlsvqg escekitheravemlrnpaspivlvvehnafhkat
>d6x1ra1 b.36.1.0 (A:93-187) automated matches {Monosiga brevicollis [TaxId: 81824]} etislhrqglgftiaggqgsphiagddgifiskiipdsaakedgrlavgdrvlsvqgesc ekitheravemlrnpaspivlvvehnafhkat
Timeline for d6x1ra1: