Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Ruminococcus champanellensis [TaxId:1161942] [396145] (2 PDB entries) |
Domain d6wqvd_: 6wqv D: [396193] automated match to d3l55b_ complexed with bgc, edo, glc, no3 |
PDB Entry: 6wqv (more details), 1.45 Å
SCOPe Domain Sequences for d6wqvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wqvd_ c.1.8.0 (D:) automated matches {Ruminococcus champanellensis [TaxId: 1161942]} mrdltasqlldeitigwnlgntldatttswlpnptpaqsetawgcpmttkamidkvkegg fntvrvpvswidhtgsapeyqideawmnrvqevvnyvidndmycilnihhendwliptna qkdsvnarldaiwtqiatrfgsydehlifegmnqprlvgdpnewnggnqearqvinsynq tfvntvratggnnairclmvptyaascssttvndfvlptdtvanklivdihsyspynfal ntsgtssftqsdisqlqwtlqeiynsfgakgipviigqfgalnknningrvlwgenylri aksynirciwwdnnafdtsgenfgllnrgtltwqypelleammk
Timeline for d6wqvd_: