SCOPe 2.06: Domain d1rldt_: 1rld T:

Lineage for d1rldt_ (1rld T:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries)

8. Domain d1rldt_: 1rld T: [39619]
   Other proteins in same PDB: d1rlda1, d1rlda2, d1rldb1, d1rldb2

Details for d1rldt_

PDB Entry: 1rld, 2.5 Å

PDB Description: solid-state phase transition in the crystal structure of ribulose 1,5-biphosphate carboxylase(slash)oxygenase

PDB Compounds: (T:) ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)

SCOPe Domain Sequences for d1rldt_:

Sequence; same for both SEQRES and ATOM records:

>d1rldt_ d.73.1.1 (T:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
egy

Timeline for d1rldt_:

• d1rldt_ first appeared (with stable ids) in SCOP 1.55
  
• d1rldt_ appears in SCOPe 2.05
  
• d1rldt_ appears in SCOPe 2.07
  
• d1rldt_ appears in the current release, SCOPe 2.08