Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species) |
Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries) |
Domain d1rldt_: 1rld T: [39619] Other proteins in same PDB: d1rlda1, d1rlda2, d1rldb1, d1rldb2 |
PDB Entry: 1rld (more details), 2.5 Å
SCOP Domain Sequences for d1rldt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rldt_ d.73.1.1 (T:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun} mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp egy
Timeline for d1rldt_: