Lineage for d1rldt_ (1rld T:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) 
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species) 
Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries) 
Domain d1rldt_: 1rld T: [39619]
Other proteins in same PDB: d1rlda1, d1rlda2, d1rldb1, d1rldb2
Details for d1rldt_
PDB Entry: 1rld (more details), 2.5 Å
PDB Description: solid-state phase transition in the crystal structure of ribulose 1,5-biphosphate carboxylase(slash)oxygenase
SCOP Domain Sequences for d1rldt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rldt_ d.73.1.1 (T:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
egy
SCOP Domain Coordinates for d1rldt_:
Click to download the PDB-style file with coordinates for d1rldt_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rldt_:
- d1rldt_ appears in SCOP 1.57
- d1rldt_ appears in the current release, SCOPe 2.08
View in 3D
