Lineage for d6wx8c_ (6wx8 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2339141Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2339142Protein automated matches [190220] (14 species)
    not a true protein
  7. 2339168Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2339187Domain d6wx8c_: 6wx8 C: [396181]
    Other proteins in same PDB: d6wx8b_, d6wx8d_
    automated match to d4uaea_
    complexed with so4

Details for d6wx8c_

PDB Entry: 6wx8 (more details), 2.3 Å

PDB Description: sox2 bound to importin-alpha 3
PDB Compounds: (C:) Importin subunit alpha-3

SCOPe Domain Sequences for d6wx8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wx8c_ a.118.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntsleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhclerddnp
slqfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalgniigdgp
qcrdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqeilpalcv
lihhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqtaalravg
nivtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvqavidanl
vpmiihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltvkdaqvvq
vvldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiidqffs

SCOPe Domain Coordinates for d6wx8c_:

Click to download the PDB-style file with coordinates for d6wx8c_.
(The format of our PDB-style files is described here.)

Timeline for d6wx8c_: