![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (27 families) ![]() |
![]() | Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
![]() | Protein automated matches [190220] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries) |
![]() | Domain d6wx8c_: 6wx8 C: [396181] Other proteins in same PDB: d6wx8b_, d6wx8d_ automated match to d4uaea_ complexed with so4 |
PDB Entry: 6wx8 (more details), 2.3 Å
SCOPe Domain Sequences for d6wx8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wx8c_ a.118.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ntsleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhclerddnp slqfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalgniigdgp qcrdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqeilpalcv lihhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqtaalravg nivtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvqavidanl vpmiihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltvkdaqvvq vvldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiidqffs
Timeline for d6wx8c_: