SCOP 1.73: Domain d1rlds_: 1rld S:

Lineage for d1rlds_ (1rld S:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries)

8. Domain d1rlds_: 1rld S: [39618]
   Other proteins in same PDB: d1rlda1, d1rlda2, d1rldb1, d1rldb2

Details for d1rlds_

PDB Entry: 1rld, 2.5 Å

PDB Description: solid-state phase transition in the crystal structure of ribulose 1,5-biphosphate carboxylase(slash)oxygenase

PDB Compounds: (S:) ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)

SCOP Domain Sequences for d1rlds_:

Sequence; same for both SEQRES and ATOM records:

>d1rlds_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
egy

Timeline for d1rlds_:

• d1rlds_ first appeared (with stable ids) in SCOP 1.55
  
• d1rlds_ appears in SCOP 1.71
  
• d1rlds_ appears in SCOP 1.75
  
• d1rlds_ appears in the current release, SCOPe 2.08