Lineage for d1rlds_ (1rld S:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413835Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 413836Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 413837Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 413838Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 413919Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries)
  8. 413922Domain d1rlds_: 1rld S: [39618]
    Other proteins in same PDB: d1rlda1, d1rlda2, d1rldb1, d1rldb2

Details for d1rlds_

PDB Entry: 1rld (more details), 2.5 Å

PDB Description: solid-state phase transition in the crystal structure of ribulose 1,5-biphosphate carboxylase(slash)oxygenase

SCOP Domain Sequences for d1rlds_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlds_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
egy

SCOP Domain Coordinates for d1rlds_:

Click to download the PDB-style file with coordinates for d1rlds_.
(The format of our PDB-style files is described here.)

Timeline for d1rlds_: