Lineage for d1rlds_ (1rld S:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2179369Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2179370Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2179371Family d.73.1.1: RuBisCO, small subunit [55240] (2 protein domains)
  6. 2179372Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 2179519Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries)
  8. 2179522Domain d1rlds_: 1rld S: [39618]
    Other proteins in same PDB: d1rlda1, d1rlda2, d1rldb1, d1rldb2

Details for d1rlds_

PDB Entry: 1rld (more details), 2.5 Å

PDB Description: solid-state phase transition in the crystal structure of ribulose 1,5-biphosphate carboxylase(slash)oxygenase
PDB Compounds: (S:) ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)

SCOPe Domain Sequences for d1rlds_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlds_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
egy

SCOPe Domain Coordinates for d1rlds_:

Click to download the PDB-style file with coordinates for d1rlds_.
(The format of our PDB-style files is described here.)

Timeline for d1rlds_: