Lineage for d1dwkj2 (1dwk J:87-156)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031312Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 1031313Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family) (S)
  5. 1031314Family d.72.1.1: Cyanase C-terminal domain [55235] (1 protein)
    active form is a decamer formed by five dimers
  6. 1031315Protein Cyanase C-terminal domain [55236] (1 species)
  7. 1031316Species Escherichia coli [TaxId:562] [55237] (4 PDB entries)
  8. 1031326Domain d1dwkj2: 1dwk J:87-156 [39615]
    Other proteins in same PDB: d1dwka1, d1dwkb1, d1dwkc1, d1dwkd1, d1dwke1, d1dwkf1, d1dwkg1, d1dwkh1, d1dwki1, d1dwkj1
    complexed with oxl, so4

Details for d1dwkj2

PDB Entry: 1dwk (more details), 1.65 Å

PDB Description: structure of cyanase with the di-anion oxalate bound at the enzyme active site
PDB Compounds: (J:) cyanate hydratase

SCOPe Domain Sequences for d1dwkj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwkj2 d.72.1.1 (J:87-156) Cyanase C-terminal domain {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

SCOPe Domain Coordinates for d1dwkj2:

Click to download the PDB-style file with coordinates for d1dwkj2.
(The format of our PDB-style files is described here.)

Timeline for d1dwkj2: