Lineage for d1dwki2 (1dwk I:87-156)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605675Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 605676Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family) (S)
  5. 605677Family d.72.1.1: Cyanase C-terminal domain [55235] (1 protein)
    active form is a decamer formed by five dimers
  6. 605678Protein Cyanase C-terminal domain [55236] (1 species)
  7. 605679Species Escherichia coli [TaxId:562] [55237] (2 PDB entries)
  8. 605688Domain d1dwki2: 1dwk I:87-156 [39614]
    Other proteins in same PDB: d1dwka1, d1dwkb1, d1dwkc1, d1dwkd1, d1dwke1, d1dwkf1, d1dwkg1, d1dwkh1, d1dwki1, d1dwkj1

Details for d1dwki2

PDB Entry: 1dwk (more details), 1.65 Å

PDB Description: structure of cyanase with the di-anion oxalate bound at the enzyme active site

SCOP Domain Sequences for d1dwki2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwki2 d.72.1.1 (I:87-156) Cyanase C-terminal domain {Escherichia coli}
riptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

SCOP Domain Coordinates for d1dwki2:

Click to download the PDB-style file with coordinates for d1dwki2.
(The format of our PDB-style files is described here.)

Timeline for d1dwki2: