Lineage for d1dwkf2 (1dwk F:87-156)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1419690Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 1419691Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family) (S)
    automatically mapped to Pfam PF02560
  5. 1419692Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
    active form is a decamer formed by five dimers
  6. 1419693Protein Cyanase C-terminal domain [55236] (1 species)
  7. 1419694Species Escherichia coli [TaxId:562] [55237] (4 PDB entries)
  8. 1419700Domain d1dwkf2: 1dwk F:87-156 [39611]
    Other proteins in same PDB: d1dwka1, d1dwkb1, d1dwkc1, d1dwkd1, d1dwke1, d1dwkf1, d1dwkg1, d1dwkh1, d1dwki1, d1dwkj1
    complexed with oxl, so4

Details for d1dwkf2

PDB Entry: 1dwk (more details), 1.65 Å

PDB Description: structure of cyanase with the di-anion oxalate bound at the enzyme active site
PDB Compounds: (F:) cyanate hydratase

SCOPe Domain Sequences for d1dwkf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwkf2 d.72.1.1 (F:87-156) Cyanase C-terminal domain {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

SCOPe Domain Coordinates for d1dwkf2:

Click to download the PDB-style file with coordinates for d1dwkf2.
(The format of our PDB-style files is described here.)

Timeline for d1dwkf2: