Lineage for d6vzdb_ (6vzd B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2717038Family a.64.1.0: automated matches [191532] (1 protein)
    not a true family
  6. 2717039Protein automated matches [190901] (2 species)
    not a true protein
  7. 2717043Species Mouse (Mus musculus) [TaxId:10090] [396003] (4 PDB entries)
  8. 2717045Domain d6vzdb_: 6vzd B: [396100]
    automated match to d4ddja_
    complexed with rxy; mutant

Details for d6vzdb_

PDB Entry: 6vzd (more details), 1.88 Å

PDB Description: n-terminal domain of mouse surfactant protein b (k46e/r51e mutant) with bound lipid
PDB Compounds: (B:) Pulmonary surfactant-associated protein B

SCOPe Domain Sequences for d6vzdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vzdb_ a.64.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlcqecedivhlltkmtkedafqeairkfleqecdilplellvpecrqvldvylplvidy
fqsqinpkaicnhvglcp

SCOPe Domain Coordinates for d6vzdb_:

Click to download the PDB-style file with coordinates for d6vzdb_.
(The format of our PDB-style files is described here.)

Timeline for d6vzdb_: