| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
Superfamily a.64.1: Saposin [47862] (5 families) ![]() Lipid-binding can promote conformational changes and oligomerisation in some members |
| Family a.64.1.0: automated matches [191532] (1 protein) not a true family |
| Protein automated matches [190901] (2 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [396003] (4 PDB entries) |
| Domain d6vzdb_: 6vzd B: [396100] automated match to d4ddja_ complexed with rxy; mutant |
PDB Entry: 6vzd (more details), 1.88 Å
SCOPe Domain Sequences for d6vzdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vzdb_ a.64.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlcqecedivhlltkmtkedafqeairkfleqecdilplellvpecrqvldvylplvidy
fqsqinpkaicnhvglcp
Timeline for d6vzdb_: