SCOPe 2.06: Domain d1dwkd2: 1dwk D:87-156

Lineage for d1dwkd2 (1dwk D:87-156)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
   intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta

4. Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families)
   automatically mapped to Pfam PF02560

5. Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
   active form is a decamer formed by five dimers

6. Protein Cyanase C-terminal domain [55236] (1 species)

7. Species Escherichia coli [TaxId:562] [55237] (2 PDB entries)

8. Domain d1dwkd2: 1dwk D:87-156 [39609]
   Other proteins in same PDB: d1dwka1, d1dwkb1, d1dwkc1, d1dwkd1, d1dwke1, d1dwkf1, d1dwkg1, d1dwkh1, d1dwki1, d1dwkj1
   complexed with oxl, so4

Details for d1dwkd2

PDB Entry: 1dwk, 1.65 Å

PDB Description: structure of cyanase with the di-anion oxalate bound at the enzyme active site

PDB Compounds: (D:) cyanate hydratase

SCOPe Domain Sequences for d1dwkd2:

Sequence; same for both SEQRES and ATOM records:

>d1dwkd2 d.72.1.1 (D:87-156) Cyanase C-terminal domain {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

Timeline for d1dwkd2:

• d1dwkd2 first appeared (with stable ids) in SCOP 1.55
  
• d1dwkd2 appears in SCOPe 2.05
  
• d1dwkd2 appears in SCOPe 2.07
  
• d1dwkd2 appears in the current release, SCOPe 2.08