Lineage for d1dwkd2 (1dwk D:87-156)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33393Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
  4. 33394Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family) (S)
  5. 33395Family d.72.1.1: Cyanase C-terminal domain [55235] (1 protein)
  6. 33396Protein Cyanase C-terminal domain [55236] (1 species)
  7. 33397Species Escherichia coli [TaxId:562] [55237] (2 PDB entries)
  8. 33411Domain d1dwkd2: 1dwk D:87-156 [39609]
    Other proteins in same PDB: d1dwka1, d1dwkb1, d1dwkc1, d1dwkd1, d1dwke1, d1dwkf1, d1dwkg1, d1dwkh1, d1dwki1, d1dwkj1

Details for d1dwkd2

PDB Entry: 1dwk (more details), 1.65 Å

PDB Description: structure of cyanase with the di-anion oxalate bound at the enzyme active site

SCOP Domain Sequences for d1dwkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwkd2 d.72.1.1 (D:87-156) Cyanase C-terminal domain {Escherichia coli}
riptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

SCOP Domain Coordinates for d1dwkd2:

Click to download the PDB-style file with coordinates for d1dwkd2.
(The format of our PDB-style files is described here.)

Timeline for d1dwkd2: