![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
![]() | Protein automated matches [190149] (14 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:487] [376758] (2 PDB entries) |
![]() | Domain d6w9td_: 6w9t D: [396087] automated match to d5g1sl_ complexed with k, khs |
PDB Entry: 6w9t (more details), 1.64 Å
SCOPe Domain Sequences for d6w9td_:
Sequence, based on SEQRES records: (download)
>d6w9td_ c.14.1.1 (D:) automated matches {Neisseria meningitidis [TaxId: 487]} vptvieqsgrgerafdiysrllkerivflvgpvtdesanlvvaqllflesenpdkdiffy inspggsvtagmsiydtmnfikpdvstlclgqaasmgafllsagekgkrfalpnsrimih qplisgglggqasdieiharellkikeklnrlmakhcdrdladlerdtdrdnfmsaeeak eyglidqilenraslr
>d6w9td_ c.14.1.1 (D:) automated matches {Neisseria meningitidis [TaxId: 487]} vptvfdiysrllkerivflvgpvtdesanlvvaqllflesenpdkdiffyinspggsvta gmsiydtmnfikpdvstlclgqaasmgafllsagekgkrfalpnsrimihqplisgqasd ieiharellkikeklnrlmakhcdrdladlerdtdrdnfmsaeeakeyglidqilenras lr
Timeline for d6w9td_: