Lineage for d1dw9h2 (1dw9 H:87-156)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726733Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 726734Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family) (S)
  5. 726735Family d.72.1.1: Cyanase C-terminal domain [55235] (1 protein)
    active form is a decamer formed by five dimers
  6. 726736Protein Cyanase C-terminal domain [55236] (1 species)
  7. 726737Species Escherichia coli [TaxId:562] [55237] (4 PDB entries)
  8. 726755Domain d1dw9h2: 1dw9 H:87-156 [39603]
    Other proteins in same PDB: d1dw9a1, d1dw9b1, d1dw9c1, d1dw9d1, d1dw9e1, d1dw9f1, d1dw9g1, d1dw9h1, d1dw9i1, d1dw9j1

Details for d1dw9h2

PDB Entry: 1dw9 (more details), 1.65 Å

PDB Description: structure of cyanase reveals that a novel dimeric and decameric arrangement of subunits is required for formation of the enzyme active site
PDB Compounds: (H:) cyanate lyase

SCOP Domain Sequences for d1dw9h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw9h2 d.72.1.1 (H:87-156) Cyanase C-terminal domain {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

SCOP Domain Coordinates for d1dw9h2:

Click to download the PDB-style file with coordinates for d1dw9h2.
(The format of our PDB-style files is described here.)

Timeline for d1dw9h2: