SCOP 1.73: Domain d1dw9f2: 1dw9 F:87-156

Lineage for d1dw9f2 (1dw9 F:87-156)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
   intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta

4. Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family)

5. Family d.72.1.1: Cyanase C-terminal domain [55235] (1 protein)
   active form is a decamer formed by five dimers

6. Protein Cyanase C-terminal domain [55236] (1 species)

7. Species Escherichia coli [TaxId:562] [55237] (4 PDB entries)

8. Domain d1dw9f2: 1dw9 F:87-156 [39601]
   Other proteins in same PDB: d1dw9a1, d1dw9b1, d1dw9c1, d1dw9d1, d1dw9e1, d1dw9f1, d1dw9g1, d1dw9h1, d1dw9i1, d1dw9j1

Details for d1dw9f2

PDB Entry: 1dw9, 1.65 Å

PDB Description: structure of cyanase reveals that a novel dimeric and decameric arrangement of subunits is required for formation of the enzyme active site

PDB Compounds: (F:) cyanate lyase

SCOP Domain Sequences for d1dw9f2:

Sequence; same for both SEQRES and ATOM records:

>d1dw9f2 d.72.1.1 (F:87-156) Cyanase C-terminal domain {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

Timeline for d1dw9f2:

• d1dw9f2 first appeared (with stable ids) in SCOP 1.55
  
• d1dw9f2 appears in SCOP 1.71
  
• d1dw9f2 appears in SCOP 1.75
  
• d1dw9f2 appears in the current release, SCOPe 2.08