Lineage for d1dw9e2 (1dw9 E:87-156)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864958Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 864959Superfamily d.72.1: Cyanase C-terminal domain [55234] (1 family) (S)
  5. 864960Family d.72.1.1: Cyanase C-terminal domain [55235] (1 protein)
    active form is a decamer formed by five dimers
  6. 864961Protein Cyanase C-terminal domain [55236] (1 species)
  7. 864962Species Escherichia coli [TaxId:562] [55237] (4 PDB entries)
  8. 864977Domain d1dw9e2: 1dw9 E:87-156 [39600]
    Other proteins in same PDB: d1dw9a1, d1dw9b1, d1dw9c1, d1dw9d1, d1dw9e1, d1dw9f1, d1dw9g1, d1dw9h1, d1dw9i1, d1dw9j1
    CASP3

Details for d1dw9e2

PDB Entry: 1dw9 (more details), 1.65 Å

PDB Description: structure of cyanase reveals that a novel dimeric and decameric arrangement of subunits is required for formation of the enzyme active site
PDB Compounds: (E:) cyanate lyase

SCOP Domain Sequences for d1dw9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw9e2 d.72.1.1 (E:87-156) Cyanase C-terminal domain {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

SCOP Domain Coordinates for d1dw9e2:

Click to download the PDB-style file with coordinates for d1dw9e2.
(The format of our PDB-style files is described here.)

Timeline for d1dw9e2: