SCOPe 2.08: Domain d1ev0b_: 1ev0 B:

Lineage for d1ev0b_ (1ev0 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.71: Cell division protein MinE topological specificity domain [55228] (1 superfamily)
   dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta

4. Superfamily d.71.1: Cell division protein MinE topological specificity domain [55229] (2 families)
   automatically mapped to Pfam PF03776

5. Family d.71.1.1: Cell division protein MinE topological specificity domain [55230] (1 protein)

6. Protein Cell division protein MinE topological specificity domain [55231] (1 species)

7. Species Escherichia coli [TaxId:562] [55232] (1 PDB entry)

8. Domain d1ev0b_: 1ev0 B: [39595]

Details for d1ev0b_

PDB Entry: 1ev0

PDB Description: solution structure of the mine topological specificity domain

PDB Compounds: (B:) mine

SCOPe Domain Sequences for d1ev0b_:

Sequence; same for both SEQRES and ATOM records:

>d1ev0b_ d.71.1.1 (B:) Cell division protein MinE topological specificity domain {Escherichia coli [TaxId: 562]}
rsdaephylpqlrkdilevickyvqidpemvtvqleqkdgdisilelnvtlpeaeelk

Timeline for d1ev0b_:

• d1ev0b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ev0b_ appears in SCOPe 2.07