Lineage for d1ev0b_ (1ev0 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524116Fold d.71: Cell division protein MinE topological specificity domain [55228] (1 superfamily)
    dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 2524117Superfamily d.71.1: Cell division protein MinE topological specificity domain [55229] (2 families) (S)
    automatically mapped to Pfam PF03776
  5. 2524118Family d.71.1.1: Cell division protein MinE topological specificity domain [55230] (1 protein)
  6. 2524119Protein Cell division protein MinE topological specificity domain [55231] (1 species)
  7. 2524120Species Escherichia coli [TaxId:562] [55232] (1 PDB entry)
  8. 2524122Domain d1ev0b_: 1ev0 B: [39595]

Details for d1ev0b_

PDB Entry: 1ev0 (more details)

PDB Description: solution structure of the mine topological specificity domain
PDB Compounds: (B:) mine

SCOPe Domain Sequences for d1ev0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev0b_ d.71.1.1 (B:) Cell division protein MinE topological specificity domain {Escherichia coli [TaxId: 562]}
rsdaephylpqlrkdilevickyvqidpemvtvqleqkdgdisilelnvtlpeaeelk

SCOPe Domain Coordinates for d1ev0b_:

Click to download the PDB-style file with coordinates for d1ev0b_.
(The format of our PDB-style files is described here.)

Timeline for d1ev0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ev0a_