SCOPe 2.07: Domain d6ut9a1: 6ut9 A:1-159

Lineage for d6ut9a1 (6ut9 A:1-159)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Rotavirus a [TaxId:10941] [187397] (2 PDB entries)

8. Domain d6ut9a1: 6ut9 A:1-159 [395888]
   Other proteins in same PDB: d6ut9a2
   automated match to d2aena_

Details for d6ut9a1

PDB Entry: 6ut9, 1.21 Å

PDB Description: crystal structure of the carbohydrate-binding domain vp8* of human p[4] rotavirus strain bm5265

PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d6ut9a1:

Sequence; same for both SEQRES and ATOM records:

>d6ut9a1 b.29.1.0 (A:1-159) automated matches {Rotavirus a [TaxId: 10941]}
vldgpyqpttfkppndywllissntdgvvyestnnsdfwtaviavephvsqtnrqyvlfg
enkqfnvennsdkwkffemfkgsgqsdfsnrrtltsnnrlvgmlkyggrvwtfhgetpra
ttdssntadlnnisiiihsefyiiprsqeskcneyinng

Timeline for d6ut9a1:

• d6ut9a1 is new in SCOPe 2.07-stable
  
• d6ut9a1 appears in the current release, SCOPe 2.08