SCOPe 2.07: Domain d6thd1_: 6thd 1:

Lineage for d6thd1_ (6thd 1:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (22 species)
   not a true protein

7. Species Bovine enterovirus (strain vg-5-27) [TaxId:12065] [395796] (2 PDB entries)

8. Domain d6thd1_: 6thd 1: [395870]
   Other proteins in same PDB: d6thd3_
   automated match to d5c4wa_
   complexed with myr, so4

Details for d6thd1_

PDB Entry: 6thd, 2.23 Å

PDB Description: multiple genomic rna-coat protein contacts play vital roles in the assembly of infectious enterovirus-e

PDB Compounds: (1:) Genome polyprotein

SCOPe Domain Sequences for d6thd1_:

Sequence; same for both SEQRES and ATOM records:

>d6thd1_ b.121.4.0 (1:) automated matches {Bovine enterovirus (strain vg-5-27) [TaxId: 12065]}
gkmlkdaidkqvagalvagtttsthsvatdstpalqaaetgatstardesmietrtivpt
hgihetsvesffgrsslvgmpllatgtsithwridfrefvqlrakmswftymrfdvefti
iatsstgqnvtteqhttyqvmyvppgapvpsnqdsfqwqsgcnpsvfadtdgppaqfsvp
fmssanaystvydgyarfmdtdpdrygilpsnflgfmyfrtledaahqvrfriyakikht
scwipraprqapykkrynlvfsgdsdricsnrasltsy

Timeline for d6thd1_:

• d6thd1_ is new in SCOPe 2.07-stable
  
• d6thd1_ appears in the current release, SCOPe 2.08