Lineage for d1eps__ (1eps -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605490Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 605500Superfamily d.68.2: EPT/RTPC-like [55205] (2 families) (S)
  5. 605510Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (2 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
  6. 605511Protein 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase [55213] (2 species)
  7. 605512Species Escherichia coli [TaxId:562] [55214] (7 PDB entries)
  8. 605517Domain d1eps__: 1eps - [39586]
    CA-atoms only

Details for d1eps__

PDB Entry: 1eps (more details), 3 Å

PDB Description: structure and topological symmetry of the glyphosphate 5-enol-pyruvylshikimate-3-phosphate synthase: a distinctive protein fold

SCOP Domain Sequences for d1eps__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eps__ d.68.2.2 (-) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli}
mesltlqpiarvdgtinlpgsktvsnralllaalahgktvltnlldsddvrhmlnaltal
gvsytlsadrtrceiignggplhaegalelflgnagtamrplaaalclgsndivltgepr
mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
lnaidmdmnhipdaamtiataalfakgttrlrniynwrvketdrlfamatelrkvgaeve
eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
arisqaa

SCOP Domain Coordinates for d1eps__:

Click to download the PDB-style file with coordinates for d1eps__.
(The format of our PDB-style files is described here.)

Timeline for d1eps__: