SCOP 1.69: Domain d1eps__: 1eps -

Lineage for d1eps__ (1eps -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.68: IF3-like [55199] (7 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.2: EPT/RTPC-like [55205] (2 families)

5. Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (2 proteins)
   duplication: 6 repeats of this fold are organized in two RPTC-like domains

6. Protein 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase [55213] (2 species)

7. Species Escherichia coli [TaxId:562] [55214] (5 PDB entries)

8. Domain d1eps__: 1eps - [39586]
   CA-atoms only

Details for d1eps__

PDB Entry: 1eps, 3 Å

PDB Description: structure and topological symmetry of the glyphosphate 5-enol-pyruvylshikimate-3-phosphate synthase: a distinctive protein fold

SCOP Domain Sequences for d1eps__:

Sequence; same for both SEQRES and ATOM records:

>d1eps__ d.68.2.2 (-) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli}
mesltlqpiarvdgtinlpgsktvsnralllaalahgktvltnlldsddvrhmlnaltal
gvsytlsadrtrceiignggplhaegalelflgnagtamrplaaalclgsndivltgepr
mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
lnaidmdmnhipdaamtiataalfakgttrlrniynwrvketdrlfamatelrkvgaeve
eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
arisqaa

Timeline for d1eps__:

• d1eps__ first appeared (with stable ids) in SCOP 1.55
  
• d1eps__ appears in SCOP 1.67
  
• d1eps__ appears in SCOP 1.71
  
• d1eps__ appears in the current release, SCOPe 2.08, called d1epsa_