Lineage for d1epsa_ (1eps A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. Protein 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase [55213] (4 species)
  7. Species Escherichia coli [TaxId:562] [55214] (16 PDB entries)
    Uniprot P07638
  8. Domain d1epsa_: 1eps A: [39586]
    CA-atoms only

Details for d1epsa_

PDB Entry: 1eps (more details), 3 Å

PDB Description: structure and topological symmetry of the glyphosphate 5-enol-pyruvylshikimate-3-phosphate synthase: a distinctive protein fold
PDB Compounds: (A:) 5-enol-pyruvyl-3-phosphate synthase

SCOPe Domain Sequences for d1epsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epsa_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]}
mesltlqpiarvdgtinlpgsktvsnralllaalahgktvltnlldsddvrhmlnaltal
gvsytlsadrtrceiignggplhaegalelflgnagtamrplaaalclgsndivltgepr
mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
lnaidmdmnhipdaamtiataalfakgttrlrniynwrvketdrlfamatelrkvgaeve
eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
arisqaa

SCOPe Domain Coordinates for d1epsa_ are not available.

Timeline for d1epsa_: