Lineage for d1g6ta_ (1g6t A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864751Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 864761Superfamily d.68.2: EPT/RTPC-like [55205] (2 families) (S)
  5. 864771Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (2 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
  6. 864772Protein 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase [55213] (2 species)
  7. 864773Species Escherichia coli [TaxId:562] [55214] (12 PDB entries)
    Uniprot P07638
  8. 864778Domain d1g6ta_: 1g6t A: [39585]
    complexed with fmt, po4, s3p

Details for d1g6ta_

PDB Entry: 1g6t (more details), 1.6 Å

PDB Description: structure of epsp synthase liganded with shikimate-3-phosphate
PDB Compounds: (A:) epsp synthase

SCOP Domain Sequences for d1g6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6ta_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]}
mesltlqpiarvdgtinlpgsksvsnralllaalahgktvltnlldsddvrhmlnaltal
gvsytlsadrtrceiignggplhaegalelflgnagtamrplaaalclgsndivltgepr
mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
lnaidmdmnhipdaamtiataalfakgtttlrniynwrvketdrlfamatelrkvgaeve
eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
arisqaa

SCOP Domain Coordinates for d1g6ta_:

Click to download the PDB-style file with coordinates for d1g6ta_.
(The format of our PDB-style files is described here.)

Timeline for d1g6ta_: