Lineage for d1g6sa_ (1g6s A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031026Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1031036Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 1031046Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
  6. 1031047Protein 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase [55213] (4 species)
  7. 1031057Species Escherichia coli [TaxId:562] [55214] (16 PDB entries)
    Uniprot P07638
  8. 1031058Domain d1g6sa_: 1g6s A: [39584]
    complexed with fmt, gpj, s3p

Details for d1g6sa_

PDB Entry: 1g6s (more details), 1.5 Å

PDB Description: structure of epsp synthase liganded with shikimate-3-phosphate and glyphosate
PDB Compounds: (A:) epsp synthase

SCOPe Domain Sequences for d1g6sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6sa_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]}
mesltlqpiarvdgtinlpgsksvsnralllaalahgktvltnlldsddvrhmlnaltal
gvsytlsadrtrceiignggplhaegalelflgnagtamrplaaalclgsndivltgepr
mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
lnaidmdmnhipdaamtiataalfakgtttlrniynwrvketdrlfamatelrkvgaeve
eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
arisqaa

SCOPe Domain Coordinates for d1g6sa_:

Click to download the PDB-style file with coordinates for d1g6sa_.
(The format of our PDB-style files is described here.)

Timeline for d1g6sa_: