![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.19: Bubble protein [103565] (1 family) ![]() automatically mapped to Pfam PF09227 |
![]() | Family g.3.19.1: Bubble protein [103566] (2 proteins) |
![]() | Protein automated matches [395836] (1 species) not a true protein |
![]() | Species Penicillium rubens [TaxId:500485] [395837] (1 PDB entry) |
![]() | Domain d6trma_: 6trm A: [395838] automated match to d1uoya_ |
PDB Entry: 6trm (more details)
SCOPe Domain Sequences for d6trma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6trma_ g.3.19.1 (A:) automated matches {Penicillium rubens [TaxId: 500485]} dtcgggygvdqrrtnspcqasngdrhfcgcdrtgiveckggkwteiqdcggascrgvsqg garc
Timeline for d6trma_: