Lineage for d6trma_ (6trm A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2636824Superfamily g.3.19: Bubble protein [103565] (1 family) (S)
    automatically mapped to Pfam PF09227
  5. 2636825Family g.3.19.1: Bubble protein [103566] (2 proteins)
  6. 2636829Protein automated matches [395836] (1 species)
    not a true protein
  7. 2636830Species Penicillium rubens [TaxId:500485] [395837] (1 PDB entry)
  8. 2636831Domain d6trma_: 6trm A: [395838]
    automated match to d1uoya_

Details for d6trma_

PDB Entry: 6trm (more details)

PDB Description: solution structure of the antifungal protein pafc
PDB Compounds: (A:) Pc21g12970 protein

SCOPe Domain Sequences for d6trma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6trma_ g.3.19.1 (A:) automated matches {Penicillium rubens [TaxId: 500485]}
dtcgggygvdqrrtnspcqasngdrhfcgcdrtgiveckggkwteiqdcggascrgvsqg
garc

SCOPe Domain Coordinates for d6trma_:

Click to download the PDB-style file with coordinates for d6trma_.
(The format of our PDB-style files is described here.)

Timeline for d6trma_: