Lineage for d1nawa_ (1naw A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33329Fold d.68: IF3-like [55199] (2 superfamilies)
  4. 33337Superfamily d.68.2: EPT/RTPC-like [55205] (2 families) (S)
  5. 33347Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (2 proteins)
  6. 33353Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (2 species)
  7. 33354Species Enterobacter cloacae [TaxId:550] [55212] (5 PDB entries)
  8. 33361Domain d1nawa_: 1naw A: [39582]

Details for d1nawa_

PDB Entry: 1naw (more details), 2 Å

PDB Description: enolpyruvyl transferase

SCOP Domain Sequences for d1nawa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nawa_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae}
mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
gtkverngsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge

SCOP Domain Coordinates for d1nawa_:

Click to download the PDB-style file with coordinates for d1nawa_.
(The format of our PDB-style files is described here.)

Timeline for d1nawa_: