SCOPe 2.08: Domain d6tpoa1: 6tpo A:21-117

Lineage for d6tpoa1 (6tpo A:21-117)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (4 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Pseudomonas aeruginosa [TaxId:208964] [395801] (2 PDB entries)

8. Domain d6tpoa1: 6tpo A:21-117 [395802]
   Other proteins in same PDB: d6tpoa2
   automated match to d1nira1
   complexed with 1pe, bu3, hec

Details for d6tpoa1

PDB Entry: 6tpo, 1.86 Å

PDB Description: conformation of cd1 nitrite reductase nirs without bound heme d1

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d6tpoa1:

Sequence; same for both SEQRES and ATOM records:

>d6tpoa1 a.3.1.2 (A:21-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 208964]}
hvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltpditqqrgqqyleali
tygtplgmpnwgssgelskeqitlmakyiqhtppqpp

Timeline for d6tpoa1:

• d6tpoa1 first appeared in SCOPe 2.07