SCOPe 2.07: Domain d6tmyf_: 6tmy F:

Lineage for d6tmyf_ (6tmy F:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (27 species)
   not a true protein

7. Species Crotalus durissus [TaxId:8732] [188410] (3 PDB entries)

8. Domain d6tmyf_: 6tmy F: [395776]
   automated match to d3r0ld_
   complexed with cl, na, pg4

Details for d6tmyf_

PDB Entry: 6tmy, 1.8 Å

PDB Description: crystal structure of isoform cbd of the basic phospholipase a2 subunit of crotoxin from crotalus durissus terrificus

PDB Compounds: (F:) Phospholipase A2 crotoxin basic subunit CBc

SCOPe Domain Sequences for d6tmyf_:

Sequence; same for both SEQRES and ATOM records:

>d6tmyf_ a.133.1.2 (F:) automated matches {Crotalus durissus [TaxId: 8732]}
hllqfnkmikfetrknaipfyafygcycgwggrgrpkdatdrccfvhdccygklakcntk
wdiyryslksgyitcgkgtwceeqicecdrvaaeclrrslstykygymfypdsrcrgpse
tc

Timeline for d6tmyf_:

• d6tmyf_ is new in SCOPe 2.07-stable
  
• d6tmyf_ appears in the current release, SCOPe 2.08