Lineage for d6t9ua_ (6t9u A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796823Protein automated matches [190044] (14 species)
    not a true protein
  7. 2796835Species Cow (Bos taurus) [TaxId:9913] [187001] (23 PDB entries)
  8. 2796838Domain d6t9ua_: 6t9u A: [395771]
    automated match to d1tgsz_
    complexed with ca, dms, mze, tfa

Details for d6t9ua_

PDB Entry: 6t9u (more details), 1.07 Å

PDB Description: bovine trypsine in complex with the synthetic inhibitor (s)-3'-(n-(1- (4-(3-(tert-butyl)ureido)piperidin-1-yl)-3-(3-carbamimidoylphenyl)-1- oxopropan-2-yl)sulfamoyl)-[1,1'-biphenyl]-3-carboximidamide (mi-490)
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d6t9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t9ua_ b.47.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d6t9ua_:

Click to download the PDB-style file with coordinates for d6t9ua_.
(The format of our PDB-style files is described here.)

Timeline for d6t9ua_: