Lineage for d1ejdb_ (1ejd B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957090Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2957100Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 2957141Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (3 species)
  7. 2957142Species Enterobacter cloacae [TaxId:550] [55212] (12 PDB entries)
    Uniprot P33038
  8. 2957144Domain d1ejdb_: 1ejd B: [39577]
    complexed with hai, po4

Details for d1ejdb_

PDB Entry: 1ejd (more details), 1.55 Å

PDB Description: Crystal structure of unliganded mura (type1)
PDB Compounds: (B:) udp-n-acetylglucosamine enolpyruvyltransferase

SCOPe Domain Sequences for d1ejdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejdb_ d.68.2.2 (B:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]}
mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
gtkverdgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge

SCOPe Domain Coordinates for d1ejdb_:

Click to download the PDB-style file with coordinates for d1ejdb_.
(The format of our PDB-style files is described here.)

Timeline for d1ejdb_: