Lineage for d6t5fb1 (6t5f B:1-234)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726458Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2726459Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2726519Protein automated matches [190238] (11 species)
    not a true protein
  7. 2726535Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)
  8. 2726581Domain d6t5fb1: 6t5f B:1-234 [395764]
    Other proteins in same PDB: d6t5fa2, d6t5fb2, d6t5fc2
    automated match to d4dnkb_
    complexed with sep

Details for d6t5fb1

PDB Entry: 6t5f (more details), 2.63 Å

PDB Description: human 14-3-3 sigma fused to the stard1 peptide including phosphoserine-195
PDB Compounds: (B:) 14-3-3 protein sigma

SCOPe Domain Sequences for d6t5fb1:

Sequence, based on SEQRES records: (download)

>d6t5fb1 a.118.7.1 (B:1-234) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegsaaagpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgsg

Sequence, based on observed residues (ATOM records): (download)

>d6t5fb1 a.118.7.1 (B:1-234) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneaagpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmk
gdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeia
nspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgsg

SCOPe Domain Coordinates for d6t5fb1:

Click to download the PDB-style file with coordinates for d6t5fb1.
(The format of our PDB-style files is described here.)

Timeline for d6t5fb1: