Lineage for d1a2na_ (1a2n A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563801Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2563818Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2563828Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 2563869Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (3 species)
  7. 2563953Species Escherichia coli [TaxId:562] [55211] (3 PDB entries)
  8. 2563959Domain d1a2na_: 1a2n A: [39575]
    complexed with tet; mutant

Details for d1a2na_

PDB Entry: 1a2n (more details), 2.8 Å

PDB Description: structure of the c115a mutant of mura complexed with the fluorinated analog of the reaction tetrahedral intermediate
PDB Compounds: (A:) udp-n-acetylglucosamine enolpyruvyl transferase

SCOPe Domain Sequences for d1a2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2na_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Escherichia coli [TaxId: 562]}
mdkfrvqgptklqgevtisgaknaalpilfaallaeepveiqnvpklkdvdtsmkllsql
gakverngsvhidardvnvfcapydlvktmrasiwalgplvarfgqgqvslpggatigar
pvdlhisgleqlgatikleegyvkasvdgrlkgahivmdkvsvgatvtimcaatlaegtt
iienaarepeivdtanflitlgakisgqgtdriviegverlgggvyrvlpdrietgtflv
aaaisrgkiicrnaqpdtldavlaklrdagadievgedwisldmhgkrpkavnvrtaphp
afptdmqaqftllnlvaegtgfitetvfenrfmhvpelsrmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkg

SCOPe Domain Coordinates for d1a2na_:

Click to download the PDB-style file with coordinates for d1a2na_.
(The format of our PDB-style files is described here.)

Timeline for d1a2na_: