Lineage for d1a2n__ (1a2n -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.68: IF3-like [55199] (2 superfamilies) Superfamily d.68.2: EPT/RTPC-like [55205] (2 families) 
Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (2 proteins) 
Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (2 species) 
Species Escherichia coli [TaxId:562] [55211] (2 PDB entries) 
Domain d1a2n__: 1a2n - [39575]
Details for d1a2n__
PDB Entry: 1a2n (more details), 2.8 Å
PDB Description: structure of the c115a mutant of mura complexed with the fluorinated analog of the reaction tetrahedral intermediate
SCOP Domain Sequences for d1a2n__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2n__ d.68.2.2 (-) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Escherichia coli}
mdkfrvqgptklqgevtisgaknaalpilfaallaeepveiqnvpklkdvdtsmkllsql
gakverngsvhidardvnvfcapydlvktmrasiwalgplvarfgqgqvslpggatigar
pvdlhisgleqlgatikleegyvkasvdgrlkgahivmdkvsvgatvtimcaatlaegtt
iienaarepeivdtanflitlgakisgqgtdriviegverlgggvyrvlpdrietgtflv
aaaisrgkiicrnaqpdtldavlaklrdagadievgedwisldmhgkrpkavnvrtaphp
afptdmqaqftllnlvaegtgfitetvfenrfmhvpelsrmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkg
SCOP Domain Coordinates for d1a2n__:
Click to download the PDB-style file with coordinates for d1a2n__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a2n__:
- d1a2n__ appears in SCOP 1.57
- d1a2n__ appears in the current release, SCOPe 2.08, called d1a2na_
View in 3D