Lineage for d6t9fb_ (6t9f B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831356Species Talaromyces verruculosus [TaxId:198730] [330334] (6 PDB entries)
  8. 2831365Domain d6t9fb_: 6t9f B: [395743]
    automated match to d5i6sa_
    complexed with nag

Details for d6t9fb_

PDB Entry: 6t9f (more details), 2.25 Å

PDB Description: crystal structure of en endoglucanase s308p from penicillium verruculosum
PDB Compounds: (B:) endoglucanase

SCOPe Domain Sequences for d6t9fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t9fb_ c.1.8.3 (B:) automated matches {Talaromyces verruculosus [TaxId: 198730]}
ssfewfgsnesgaefgsgnipgvegtdytfpnttaiqilidagmnifrvpflmermipte
mtgsldtayfegysevinyitgkgahavvdphnfgryygtpisstsdfqtfwstlasqfk
sndlvifdtnneyhdmdesvvvalnqaaidgirdagattqyifvegnaysgawtwttynt
amvnltdpsdlivyemhqyldsdgsgtsdqcvsstvgqervvdattwlqsngklgilgef
aggansvceeavegmldylaensdvwlgaswwsagpwwqdyiysmeppngiayesylpil
etyf

SCOPe Domain Coordinates for d6t9fb_:

Click to download the PDB-style file with coordinates for d6t9fb_.
(The format of our PDB-style files is described here.)

Timeline for d6t9fb_: