SCOPe 2.08: Domain d1uaea_: 1uae A:

Lineage for d1uaea_ (1uae A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.2: EPT/RTPC-like [55205] (3 families)

5. Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
   duplication: 6 repeats of this fold are organized in two RPTC-like domains
   automatically mapped to Pfam PF00275

6. Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (3 species)

7. Species Escherichia coli [TaxId:562] [55211] (3 PDB entries)

8. Domain d1uaea_: 1uae A: [39574]
   complexed with ffq, ud1

Details for d1uaea_

PDB Entry: 1uae, 1.8 Å

PDB Description: structure of udp-n-acetylglucosamine enolpyruvyl transferase

PDB Compounds: (A:) udp-n-acetylglucosamine enolpyruvyl transferase

SCOPe Domain Sequences for d1uaea_:

Sequence; same for both SEQRES and ATOM records:

>d1uaea_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Escherichia coli [TaxId: 562]}
mdkfrvqgptklqgevtisgaknaalpilfaallaeepveiqnvpklkdvdtsmkllsql
gakverngsvhidardvnvfcapydlvktmrasiwalgplvarfgqgqvslpggctigar
pvdlhisgleqlgatikleegyvkasvdgrlkgahivmdkvsvgatvtimcaatlaegtt
iienaarepeivdtanflitlgakisgqgtdriviegverlgggvyrvlpdrietgtflv
aaaisrgkiicrnaqpdtldavlaklrdagadievgedwisldmhgkrpkavnvrtaphp
afptdmqaqftllnlvaegtgfitetvfenrfmhvpelsrmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkg

Timeline for d1uaea_:

• d1uaea_ first appeared (with stable ids) in SCOP 1.55, called d1uae__
  
• d1uaea_ appears in SCOPe 2.07